PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca17969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 293aa    MW: 33390.9 Da    PI: 7.4969
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca17969.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.73.9e-5291331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelvv+yL++k++++++++  +i+e+d+yk++Pw+Lp+k+  +ekew+fFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   ++
  Dca17969.1   9 LPPGFRFHPTDEELVVYYLCRKCASQSISV-PIIAEIDLYKFDPWQLPEKALYGEKEWFFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKT 104
                 79****************************.88***************8777889*************************************98..778 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  g+kk Lvfy g+apkg+kt+W+mheyrl
  Dca17969.1 105 LGIKKALVFYAGKAPKGVKTNWIMHEYRL 133
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-623159IPR003441NAC domain
PROSITE profilePS5100559.6759159IPR003441NAC domain
PfamPF023652.4E-2710133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MMSSQELVLP PGFRFHPTDE ELVVYYLCRK CASQSISVPI IAEIDLYKFD PWQLPEKALY  60
GEKEWFFFSP RDRKYPNGSR PNRAAGTGYW KATGADKPIG KPKTLGIKKA LVFYAGKAPK  120
GVKTNWIMHE YRLANVDRSA GKRTNLRLDD WVLCRIYNKK GTIEKGTTSS NMIEDHNPIT  180
SNDSEFEDRK PIISTRNVGF APTQPKNDLL HFDTSDSVPR CHTDTSGSGL VASPEFMCDK  240
EVQSEAKWNE LGQSMDVPFN YMDPFPDDPF TNPTQFQHNQ MSASLQDIFM LLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-8431659174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674351.11e-169PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-119NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A0J8CPM61e-169A0A0J8CPM6_BETVU; Uncharacterized protein
STRINGVIT_18s0001g02300.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-118NAC family protein